Weeks

  • Principles & Practices (David Kong, George Church, Joe Jacobson)
    Lab: Pipetting
  • DNA Read, Write, & Edit (George Church, Joe Jacobson, Emily Leproust)
    Lab: DNA Gel Art
  • Protein Design Part I (Thras Karydis, Jon Kaufman)
    Lab: Protein Design I
  • Protein Design Part II (Pranam Chatterjee, Gabriele Corso)
  • Genetic Circuits Part I: Assembly Technologies (Doug Densmore, Traci Haddock)
    Lab: Gibson Assembly
  • Genetic Circuits Part II: Neuromorphic Circuits (Ron Weiss, Evan Holbrook)
    Lab: Neuromorphic Circuits
  • Cell-Free Systems (Kate Adamala, Peter Nguyen, Ally Huang)
    Lab: Cell-Free Systems
  • Advanced Imaging & Measurement Tech (Evan Daugharthy, Waters Corp.)
    Lab: Mass Spectrometry
  • Building Genomes (George Church, John Glass, Jef Boeke)
    Lab: Bioproduction
  • Biodesign & Engineered Living Materials; Frugal Science (Manu Prakash, David Kong)
    Lab: (Final Project work)
  • Bio Design & Bio Fabrication (Suzanne Lee, Christina Agapakis)
    Lab: (Final Project work)


Switch view to Labs

Subsections of Weeks

Week 1 — Principles & Practices

cover image cover image

This week lays the foundation for ethics, safety, and governance in biotechnology — and we get hands-on with lab basics.

Lecture (Tues, Feb 3)

Principles & Practices
(▶️Recording)
David Kong
George Church
Joe Jacobson

Recitation (Wed, Feb 4)

Principles, Ethics, Practices
(▶️Recording | 💻Slides)
Ronan Donovan
Suvin Sundararajan
Subastian Kamau
Greg Galperin

Lab (Thurs-Fri, Feb 5 - 6)

Homework — DUE BY START OF FEB 10 LECTURE

Documentation

Make sure to document every step of the in-silico and lab experiments. Make sketches, screenshots, notes, drawings - anything that helps you - and others understand the experiment.

Your Documentation should help you - and others - to understand the topic. Don’t be afraid to add things that don’t work. Show your failures - and how you overcame them. Your Documentation should be a description of the amazing journey you are on!

Overview

Ethics, safety, and security are essential considerations throughout (and beyond!) this class. We have therefore designed the Class Assignment this week to give you a strong foundation, and then will ask you to reflect each week and in the design of your final project.

Questions?

MIT / Harvard students: htgaa2026-TAs@media.mit.edu
Global students: htgaa2026-globalTAs@media.mit.edu
Need help with webpages? Editing/Publishing Category

Class Assignment — DUE BY START OF FEB 10 LECTURE

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired
  1. First, describe a biological engineering application or tool you want to develop and why. This could be inspired by an idea for your HTGAA class project and/or something for which you are already doing in your research, or something you are just curious about.
  2. Next, describe one or more governance/policy goals related to ensuring that this application or tool contributes to an “ethical” future, like ensuring non-malfeasance (preventing harm). Break big goals down into two or more specific sub-goals. Below is one example framework (developed in the context of synthetic genomics) you can choose to use or adapt, or you can develop your own. The example was developed to consider policy goals of ensuring safety and security, alongside other goals, like promoting constructive uses, but you could propose other goals for example, those relating to equity or autonomy.
  3. Next, describe at least three different potential governance “actions” by considering the four aspects below (Purpose, Design, Assumptions, Risks of Failure & “Success”). Try to outline a mix of actions (e.g. a new requirement/rule, incentive, or technical strategy) pursued by different “actors” (e.g. academic researchers, companies, federal regulators, law enforcement, etc). Draw upon your existing knowledge and a little additional digging, and feel free to use analogies to other domains (e.g. 3D printing, drones, financial systems, etc.).
    1. Purpose: What is done now and what changes are you proposing?
    2. Design: What is needed to make it “work”? (including the actor(s) involved - who must opt-in, fund, approve, or implement, etc)
    3. Assumptions: What could you have wrong (incorrect assumptions, uncertainties)?
    4. Risks of Failure & “Success”: How might this fail, including any unintended consequences of the “success” of your proposed actions?
  4. Next, score (from 1-3 with, 1 as the best, or n/a) each of your governance actions against your rubric of policy goals. The following is one framework but feel free to make your own:
Does the option:Option 1Option 2Option 3
Enhance Biosecurity
• By preventing incidents
• By helping respond
Foster Lab Safety
• By preventing incident
• By helping respond
Protect the environment
• By preventing incidents
• By helping respond
Other considerations
• Minimizing costs and burdens to stakeholders
• Feasibility?
• Not impede research
• Promote constructive applications
  1. Last, drawing upon this scoring, describe which governance option, or combination of options, you would prioritize, and why. Outline any trade-offs you considered as well as assumptions and uncertainties. For this, you can choose one or more relevant audiences for your recommendation, which could range from the very local (e.g. to MIT leadership or Cambridge Mayoral Office) to the national (e.g. to President Biden or the head of a Federal Agency) to the international (e.g. to the United Nations Office of the Secretary-General, or the leadership of a multinational firm or industry consortia). These could also be one of the “actor” groups in your matrix.

Reflecting on what you learned and did in class this week, outline any ethical concerns that arose, especially any that were new to you. Then propose any governance actions you think might be appropriate to address those issues. This should be included on your class page for this week.


Assignment (Final Project) – Due as part of your Final Project presentation (not Feb 10)

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

As part of your final project, design one or more strategies to ensure that your project, and what it enables, contributes to growing an ethical biological future.


Assignment (Lab Preparation) — DUE BY START OF FEB 10 LECTURE

Assignees for this section
MIT/Harvard studentsRequired
Committed Listeners(Not Applicable)

Lab Training (failure to complete this will jeopardize your acceptance into the course)

  • Complete Lab Specific Training in Person.
  • Complete Safety Training in Atlas
    • Navigate to atlas.mit.edu and on the right-hand side, click “Learning Center”
    • Head to the Course Catalog and find the following two courses:
      • General Biosafety for Researchers (EHS00260w)
      • Managing Hazardous Waste (EHS00501w)

Assignment (Week 2 Lecture Prep) — DUE BY START OF FEB 10 LECTURE

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

In preparation for Week 2’s lecture on “DNA Read, Write, and Edit," please review these materials:

  1. Lecture 2 slides as posted below.
  2. The associated papers that are referenced in those slides.

In addition, answer these questions in each faculty member’s section:

Homework Questions from Professor Jacobson: [Lecture 2 slides]

  1. Nature’s machinery for copying DNA is called polymerase. What is the error rate of polymerase? How does this compare to the length of the human genome. How does biology deal with that discrepancy?
  2. How many different ways are there to code (DNA nucleotide code) for an average human protein? In practice what are some of the reasons that all of these different codes don’t work to code for the protein of interest?

Homework Questions from Dr. LeProust: [Lecture 2 slides]

  1. What’s the most commonly used method for oligo synthesis currently?
  2. Why is it difficult to make oligos longer than 200nt via direct synthesis?
  3. Why can’t you make a 2000bp gene via direct oligo synthesis?

Homework Question from George Church: [Lecture 2 slides]

Choose ONE of the following three questions to answer; and please cite AI prompts or paper citations used, if any.

  1. [Using Google & Prof. Church’s slide #4]   What are the 10 essential amino acids in all animals and how does this affect your view of the “Lysine Contingency”?
  2. [Given slides #2 & 4 (AA:NA and NA:NA codes)]   What code would you suggest for AA:AA interactions?
  3. [(Advanced students)]   Given the one paragraph abstracts for these real 2026 grant programs sketch a response to one of them or devise one of your own:

Assignment (Your HTGAA Website) — DUE BY START OF FEB 10 LECTURE

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired
  1. Begin personalizing your HTGAA website in in https://edit.htgaa.org/, starting with your homepage — fill in the template with information about yourself, or remove what’s there and make it your own. Be creative!
  2. As with all assignments in HTGAA, be sure to write up every part of this Homework on your HTGAA website in order to receive credit.
Important

In order to continue in this course you need two things:

  1. This homework completed and written up on your HTGAA website on pages.htgaa.org — make sure you’ve checked your published website on pages.htgaa.org and are happy with how it shows up there; if your homework is not visible on your pages.htgaa.org website course staff won’t see it and you will not be selected to continue in the course!
  2. For this week only, AFTER your homework is complete and published on pages.htgaa.org, fill out the Homework 1 Completion form which David emailed out just after Lecture 1. This Google form expresses your interest in continuing with the course. Without both of these you will not be accepted into HTGAA!

Reading & Resources (click to expand)

Lab-specific

Governance & ethics

Subsections of Week 1 (Feb 3)

Lab (Week 1) — Introduction to Pipetting and Dilutions

cover image cover image

Overview

Objective

Welcome to HTGAA! This is our very first lab, and in this lab we will introduce students to the foundational techniques of pipetting and serial dilutions, critical for precise liquid handling and solution preparation in biological and chemical experiments.

This is a one-day lab with two protocols covered on mixing colors and dilution. By the end of the lab, students will confidently use pipettes, prepare solutions with desired concentrations, and troubleshoot common errors in pipetting.

Concepts Learned & Skills Gained

Students will:

  • Understand Units and Conversions: moles (mol), molarity (M), and conversions between µL, mL, and L.
  • Perform Serial Dilutions: Learn the stepwise dilution process to achieve specific solution concentrations.
  • Gain Pipetting Proficiency: Operate P20, P200, and P1000 pipettes accurately for volume transfers.
  • Visualize Mixing Outcomes: Use colors and absorbance measurements to observe concentration gradients.

Pre-Lab

Reading

Key Definitions

Here are some key definitions we’d like you to know before you get started.

  • Moles (mol): A unit representing $6.022 \times 10^{23}$ particles (atoms, molecules, etc.).
  • Molarity (M): Concentration defined as moles of solute per liter of solution (mol/L).
  • Conversions:
    • 1 L = 1000 mL = 1,000,000 μL 1 M = 1000 mM = 1,000,000 μM

Planning Your Experiments

To calculate the volume of water needed for a dilution, use the formula: $$C_1 V_1 = C_2 V_2$$

Where:

  • $C_1$ : Initial concentration (stock concentration).
  • $V_1$ : Volume of stock solution needed.
  • $C_2$ : Final concentration (desired concentration).
  • $V_2$ : Final volume (total volume of the diluted solution).

Steps:

  1. Rearrange the formula to calculate $V_1$: $$ V_1 = \frac{C_2 V_2}{C_1} $$

  2. Calculate the volume of water (let’s call it $V_Water$) to add: $$ V_Water = V_2 - V_1 $$

Practice

Dilution Practice 1

  • Scenario: The stock concentration of a mystery substance (MS) is 5 M. Calculate how to dilute to 100 µM (0.1 mM):
    • Use sequential 1:499 and 1:99 dilution steps for accurate preparation.
      • Step 1: Dilute 5 M (5,000,000 µM) to 10,000 µM (500x dilution).
      • Step 2: Dilute 10,000 µM to 100 µM (100x dilution).

Dilution Practice 2

  1. The stock concentration of a mystery substance (MS) is 5 M.
    1. If the molar mass of MS is 532 g/mol, what’s the concentration of the stock concentration in g/mL? To make your life easier, you can use one of many online calculators.
  2. You will perform a serial dilution to get 100 uM of MS. Devise a plan to dilute a 5 M MS solution to 100 uM. How many dilution steps will we need? Which tubes should we use? Which pipettes?
  3. Fill out the following chart to prepare a final reaction with 60 uL reaction volume. Why did we make 100 uM MS if we actually need 40 uM MS? Why not prepare 40 uM in serial dilutions?
ReagentStock concentrationDesired concentrationVolume
Loading dye6X1X
MS100 uM40 uM
dH2On/an/a
Note

Please fill this out before coming to lab.

Additional resources

You must watch or be able to understand the following videos:


Protocol

Overview

Materials

Eppendorf Tube

Eppendorf Tube

PCR Tube Strip

PCR Tube Strip

  • Pipettes
    • P20: 1-20uL of liquid
    • P200: 20-200uL
    • P1000: 100-1000uL
    • Pipette tips: 10uL, 200uL, 1000uL
  • Tubes
    • Eppendorf tube (see image)
    • PCR tubes: (see image)
  • Tube holder
  • Stock reagents
    • dH2O
    • Mysterious substance (food coloring with water), henceforth: MS
      • Red, Blue and Yellow food coloring solutions
    • Gel loading dye (commonly used reagents for loading gels, strong purple color)

Part 1: Mixing Color

  1. Prepare tubes with red, yellow, and blue food coloring solutions OR watercolor
  2. Take ten tubes and mark them with numbers 1 to 6
  3. Tube 1, 2 and 3: add 500 uL each red, yellow, and blue solution to the tube.
  4. Tube 4: add 220 uL red solution to the tube, and add 220 uL yellow solution.
    1. Try adding this in 2 steps: add 200 uL first, and then 20 uL. Discard your tips after you add one color!
  5. Tube 5: add 525 uL yellow solution to the tube, and add 525 uL blue solution.
  6. Tube 6: add 155 uL red solution to the tube, and add 155 uL blue solution. Now you have a rainbow! You can try mixing other colors with the solutions.
  7. Try plating different volumes (e.g. 1uL, 2uL, 5uL, 10uL) on a petri plate to make some designs and build your intuitive understanding of these volumes.

Part 2: Performing Serial Dilution

  1. Perform serial dilutions to get 100 uM (0.1 mM) of MS.
    • Every time you mix in liquid, pipette up and down three or four times to ensure the two liquids are mixed thoroughly.
    • Mark each tube with its respective concentration using a pen.
  2. Prepare a final reaction of 60 uL based on your table in the pre-lab.
  3. Bonus: Take 20 uL from the final reaction and pipette it to a pre-prepared gel well. Wells are a bit trickier because they are thin and your pipette tip will puncture the gel if you’re not careful. Be gentle!

Lab Material for TAs/Nodes

Week 2 — DNA Read, Write, & Edit

cover image cover image

This week explores the read–write–edit toolkit: sequencing and synthesis workflows, restriction digests and gel electrophoresis, and early genome-editing frameworks.

Lecture (Tues, Feb 10)

DNA Read, Write, & Edit
George Church [slides]
Joe Jacobson [slides]
Emily Leproust [slides]

Recitation (Wed, Feb 11)

DNA Gel, restriction enzymes, Benchling intro, Twist intro
(▶️Recording | 💻Slides)
Ice Kiattisewee

Lab (Thurs-Fri, Feb 12 - 13)

Homework — DUE BY FEB 17 2PM MIT TIME

Questions?

MIT / Harvard students: htgaa2026-TAs@media.mit.edu
Global students: htgaa2026-globalTAs@media.mit.edu
Need help with webpages? Editing/Publishing Category

Documentation

Make sure to document every step of the in-silico and lab experiments. Make sketches, screenshots, notes, drawings… anything that helps you - and others - understand the experiment.

Your documentation should help you - and others - to understand the topic. Don’t be afraid to add things that don’t work. Show your failures - and how you overcame them. Your Documentation should be a description of the amazing journey you are on!

Part 0: Basics of Gel Electrophoresis

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

Attend or watch all lecture and recitation videos. Optionally watch bootcamp.

Part 1: Benchling & In-silico Gel Art

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

See this week’s lab protocol “Gel Art: Restriction Digests and Gel Electrophoresis” for details. Overview:

  • Make a free account at benchling.com
  • Import the Lambda DNA.
  • Simulate Restriction Enzyme Digestion with the following Enzymes:
    • EcoRI
    • HindIII
    • BamHI
    • KpnI
    • EcoRV
    • SacI
    • SalI
  • Create a pattern/image in the style of Paul Vanouse’s Latent Figure Protocol artworks.
  • You might find Ronan’s website a helpful tool for quickly iterating on designs!

Part 2: Gel Art - Restriction Digests and Gel Electrophoresis

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersOptional (for those with Lab access)

In the wet-lab perform the lab experiment you designed in Part 1 and outlined in this week’s lab protocol “Gel Art: Restriction Digests and Gel Electrophoresis”.

Part 3: DNA Design Challenge

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

3.1. Choose your protein.

In recitation, we discussed that you will pick a protein for your homework that you find interesting. Which protein have you chosen and why? Using one of the tools described in recitation (NCBI, UniProt, google), obtain the protein sequence for the protein you chose.

[Example from our group homework, you may notice the particular format — The example below came from UniProt]

>sp|P03609|LYS_BPMS2 Lysis protein OS=Escherichia phage MS2 OX=12022 PE=2 SV=1 METRFPQQSQQTPASTNRRRPFKHEDYPCRRQQRSSTLYVLIFLAIFLSKFTNQLLLSLL EAVIRTVTTLQQLLT

3.2. Reverse Translate: Protein (amino acid) sequence to DNA (nucleotide) sequence.

The Central Dogma discussed in class and recitation describes the process in which DNA sequence becomes transcribed and translated into protein. The Central Dogma gives us the framework to work backwards from a given protein sequence and infer the DNA sequence that the protein is derived from. Using one of the tools discussed in class, NCBI or online tools (google “reverse translation tools”), determine the nucleotide sequence that corresponds to the protein sequence you chose above.

[Example: Get to the original sequence of phage MS2 L-protein from its genome phage MS2 genome - Nucleotide - NCBI]

Lysis protein DNA sequence
atggaaacccgattccctcagcaatcgcagcaaactccggcatctactaatagacgccggccattcaaacatgaggattacccatgtcgaagacaacaaagaagttcaactctttatgtattgatcttcctcgcgatctttctctcgaaatttaccaatcaattgcttctgtcgctactggaagcggtgatccgcacagtgacgactttacagcaattgcttacttaa

3.3. Codon optimization.

Once a nucleotide sequence of your protein is determined, you need to codon optimize your sequence. You may, once again, utilize google for a “codon optimization tool”. In your own words, describe why you need to optimize codon usage. Which organism have you chosen to optimize the codon sequence for and why?

[Example from Codon Optimization Tool | Twist Bioscience while avoiding Type IIs enzyme recognition sites BsaI, BsmBI, and BbsI]

Lysis protein DNA sequence with Codon-Optimization
ATGGAAACCCGCTTTCCGCAGCAGAGCCAGCAGACCCCGGCGAGCACCAACCGCCGCCGCCCGTTCAAACATGAAGATTATCCGTGCCGTCGTCAGCAGCGCAGCAGCACCCTGTATGTGCTGATTTTTCTGGCGATTTTTCTGAGCAAATTCACCAACCAGCTGCTGCTGAGCCTGCTGGAAGCGGTGATTCGCACAGTGACGACCCTGCAGCAGCTGCTGACCTAA

3.4. You have a sequence! Now what?

What technologies could be used to produce this protein from your DNA? Describe in your words the DNA sequence can be transcribed and translated into your protein. You may describe either cell-dependent or cell-free methods, or both.

3.5. [Optional] How does it work in nature/biological systems?

  1. Describe how a single gene codes for multiple proteins at the transcriptional level.
  2. Try aligning the DNA sequence, the transcribed RNA, and also the resulting translated Protein!!! See example below.

[Example shows the biomolecular flow in central dogma from DNA to RNA to Protein] Special note that all “T” were transcribed into “U” and that the 3-nt codon represents 1-AA.

Rearranged snapshot of MS2 L-protein information flow from DNA to RNA to Protein. Captured from Ice’s Benchling and stitched together in a ppt

Rearranged snapshot of MS2 L-protein information flow from DNA to RNA to Protein. Captured from Ice’s Benchling and stitched together in a ppt

Part 4: Prepare a Twist DNA Synthesis Order

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

This is a practice exercise, not necessarily your real Twist order!

4.1. Create a Twist account and a Benchling account

click through for Twist signup

click through for Twist signup

click through for Benchling signup

click through for Benchling signup

4.2. Build Your DNA Insert Sequence

For example, let’s make a sequence that will make E. coli glow fluorescent green under UV light by constitutively (always) expressing sfGFP (a green fluorescent protein):

In Benchling, select New DNA/RNA sequence

Give your insert sequence a name and select DNA with a Linear topology (this is a linear sequence that will be inserted into a circular backbone vector of our choosing).

Go through each piece of the given DNA sequences highlighted below (Promoter, RBS, Start Codon, Coding Sequence, His Tag, Stop Codon, Terminator) and paste the sequences into the Benchling file one after the other (replacing the coding sequence with your codon optimized DNA sequence of interest!). Each time you add a new piece of the sequence, make sure to annotate by right clicking over the sequence and creating an annotation that describes what each piece (e.g., Promoter, RBS, etc.) is (see image below).

  • Promoter (e.g. BBa_J23106): TTTACGGCTAGCTCAGTCCTAGGTATAGTGCTAGC
  • RBS (e.g. BBa_B0034 with spacers for optimal expression): CATTAAAGAGGAGAAAGGTACC
  • Start Codon: ATG
  • Coding Sequence (your codon optimized DNA for a protein of interest, sfGFP for example): AGCAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCCGTGGAGAGGGTGAAGGTGATGCTACAAACGGAAAACTCACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCGTGGCCAACACTTGTCACTACTCTGACCTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGACCTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATCGTATCGAGTTAAAGGGTATTGATTTTAAAGAAGATGGAAACATTCTTGGACACAAACTCGAGTACAACTTTAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTAACTTCAAAATTCGCCACAACGTTGAAGATGGTTCCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCGACACAATCTGTCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAA
  • 7x His Tag (Let’s add a 7×His tag at the C-terminus of the protein to enable protein purification from E. coli): CATCACCATCACCATCATCAC
  • Stop Codon: TAA
  • Terminator (e.g. BBa_B0015): CCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGTTTTATCTGTTGTTTGTCGGTGAACGCTCTCTACTAGAGTCACACTGGCTCACCTTCGGGTGGGCCTTTCTGCGTTTATA

Once you’ve completed this, click on Linear Map to preview the entire sequence. If you intend to have a TA review a sequence in the future, this is a good way to verify that all sections are annotated!

This is not required for this exercise, but to share your design with others, please ensure that link sharing is turned on! (Optional) Share your final sequence link with a TA for review!

This insert sequence you built is commonly referred to as an expression cassette in molecular biology (a sequence you can drop into any vector and it’ll perform its function). Go ahead and download the FASTA file for the sequence you made.

It’s helpful to visualize DNA designs using SBOL Canvas (Synthetic Biology Open Language) to convey your designs. Here’s an example of what you just annotated in Benchling:

4.3. On Twist, Select The “Genes” Option

4.4. Select “Clonal Genes” option

For this demonstration, we’ll choose Clonal Genes. You’ll select clonal genes or gene fragments depending on your final project.

Historically, HTGAA projects using clonal genes (circular DNA) have reached experimental results 1-2 weeks quicker because they can be transformed directly into E. coli without additional assembly.

Gene fragments (linear DNA) offer greater design flexibility but typically require an assembly or cloning step prior to transformation. An advantage is If designed with the appropriate exonuclease protection, gene fragments can be used directly in cell-free expression.

4.5. Import your sequence

You just took an amino acid sequence of interest and converted it into DNA, codon optimized it, and built an expression cassette around it! Choose the Nucleotide Sequence option and Upload Sequence File to upload your FASTA file.

4.6. Choose Your Vector

Since we’re ordering a clonal gene, you will need to refer to Twist’s Vector Catalog to choose your circular backbone. You can think of this as taking your linear expression cassette for your protein of interest, and completing the rest of the circle!

The backbone confers many special properties like antibiotic resistance, an origin of replication, and more. Discuss with your node to decide on appropriate antibiotic options. At MIT/Harvard, you can use Ampicillin, Chloramphenicol, or Kanamycin resistance.

Twist vectors do not contain restriction sites near the insert fragment, so make sure to flank your design with cut sites if you are intending to extract this DNA insert fragment later.

For this demonstration, choose a Twist cloning vectors like pTwist Amp High Copy.


Click into your sequence and select download construct (GenBank) to get the full plasmid sequence:


Go back to your Benchling account. Inside of a folder, click the import DNA/RNA sequence button and upload the GenBank file you just downloaded.

This is the plasmid you just built with your expression cassette included. Congratulations on building your first plasmid!

Important

For your final projects, remember to include:

  1. Fully annotated Benchling insert fragment
  2. Desired Twist cloning vector

Part 5: DNA Read/Write/Edit

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

5.1 DNA Read

(i) What DNA would you want to sequence (e.g., read) and why? This could be DNA related to human health (e.g. genes related to disease research), environmental monitoring (e.g., sewage waste water, biodiversity analysis), and beyond (e.g. DNA data storage, biobank).

DNA-based digital data storage technology. Source: Archives in DNA: Workshop Exploring Implications of an Emerging Bio-Digital Technology through Design Fiction - Scientific Figure on ResearchGate. Available from: https://www.researchgate.net/figure/DNA-based-digital-data-storage-technology_fig1_353128454 [accessed 11 Feb 2025]

DNA-based digital data storage technology. Source: Archives in DNA: Workshop Exploring Implications of an Emerging Bio-Digital Technology through Design Fiction - Scientific Figure on ResearchGate. Available from: https://www.researchgate.net/figure/DNA-based-digital-data-storage-technology_fig1_353128454 [accessed 11 Feb 2025]

(ii) In lecture, a variety of sequencing technologies were mentioned. What technology or technologies would you use to perform sequencing on your DNA and why?
Also answer the following questions:

  1. Is your method first-, second- or third-generation or other? How so?
  2. What is your input? How do you prepare your input (e.g. fragmentation, adapter ligation, PCR)? List the essential steps.
  3. What are the essential steps of your chosen sequencing technology, how does it decode the bases of your DNA sample (base calling)?
  4. What is the output of your chosen sequencing technology?

5.2 DNA Write

(i) What DNA would you want to synthesize (e.g., write) and why? These could be individual genes, clusters of genes or genetic circuits, whole genomes, and beyond. As described in class thus far, applications could range from therapeutics and drug discovery (e.g., mRNA vaccines and therapies) to novel biomaterials (e.g. structural proteins), to sensors (e.g., genetic circuits for sensing and responding to inflammation, environmental stimuli, etc.), to art (DNA origamis). If possible, include the specific genetic sequence(s) of what you would like to synthesize! You will have the opportunity to actually have Twist synthesize these DNA constructs! :)

See some famous examples of DNA design

DNA origami by Paul W. K. Rothemund, California Institute of Technology, 2004. 100 nanometers in diameter.

DNA origami by Paul W. K. Rothemund, California Institute of Technology, 2004. 100 nanometers in diameter.

(ii) What technology or technologies would you use to perform this DNA synthesis and why?
Also answer the following questions:

  1. What are the essential steps of your chosen sequencing methods?
  2. What are the limitations of your sequencing method (if any) in terms of speed, accuracy, scalability?

5.3 DNA Edit

(i) What DNA would you want to edit and why? In class, George shared a variety of ways to edit the genes and genomes of humans and other organisms. Such DNA editing technologies have profound implications for human health, development, and even human longevity and human augmentation. DNA editing is also already commonly leveraged for flora and fauna, for example in nature conservation efforts, (animal/plant restoration, de-extinction), or in agriculture (e.g. plant breeding, nitrogen fixation). What kinds of edits might you want to make to DNA (e.g., human genomes and beyond) and why?

Colossal Biosciences Inc., a biotechnology company using genetic engineering to de-extinct various historic animals such as the woolly mammoth, dodo, and dire wolf.

Colossal Biosciences Inc., a biotechnology company using genetic engineering to de-extinct various historic animals such as the woolly mammoth, dodo, and dire wolf.

(ii) What technology or technologies would you use to perform these DNA edits and why?
Also answer the following questions:

  1. How does your technology of choice edit DNA? What are the essential steps?
  2. What preparation do you need to do (e.g. design steps) and what is the input (e.g. DNA template, enzymes, plasmids, primers, guides, cells) for the editing?
  3. What are the limitations of your editing methods (if any) in terms of efficiency or precision?

Reading & Resources (click to expand)

Resources

Databases

Editors and tutorials

Additional Resources:

Subsections of Week 2 (Feb 10)

Week 3 — Lab Automation

This week we get hands-on (or at least code-on) with pipetting robots.

Lecture (Tues, Feb 17)


NO LECTURE THIS WEEK!


Recitation (Wed, Feb 18)

Lab automation: autonomous lab intro
(▶️Recording | 💻Slides)
Ronan Donovan, Alex Tran, Ana Arkhipenkova, Kourosh Afshinjoo

Lab (Thurs-Fri, Feb 19 - 20)

Homework

Assignment: Python Script for Opentrons Artwork — DUE BY YOUR LAB TIME!

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

Your task this week is to Create a Python file to run on an Opentrons liquid handling robot.

  1. Review this week’s recitation and this week’s lab for details on the Opentrons and programming it.
  2. Generate an artistic design using the GUI at opentrons-art.rcdonovan.com.
  3. Using the coordinates from the GUI, follow the instructions in the HTGAA26 Opentrons Colab to write your own Python script which draws your design using the Opentrons.
    • You may use AI assistance for this coding — Google Gemini is integrated into Colab (see the stylized star bottom center); it will do a good job writing functional Python, while you probably need to take charge of the art concept.
    • If you’re a proficient programmer and you’d rather code something mathematical or algorithmic instead of using your GUI coordinates, you may do that instead.
    Ask for help early!

    If you are having any trouble with scripting, contact your TAs as soon as possible for help.
    Do not wait until your scheduled robot time slot or you may not be able to complete this assignment!

  4. If the Python component is proving too problematic even with AI and human assistance, download the full Python script from the GUI website and submit that:
    Use the download icon pointed to by the red arrow in this diagram.

    Use the download icon pointed to by the red arrow in this diagram.

  5. If you use AI to help complete this homework or lab, document how you used AI and which models made contributions.
  6. Sign up for a robot time slot if you are at MIT/Harvard/Wellesley or at a Node offering Opentrons automation. The Python script you created will be run on the robot to produce your work of art!
    • At MIT/Harvard? Lab times are on Thursday Feb.19 between 10AM and 6PM.
    • At other Nodes? Please coordinate with your Node.
  7. Submit your Python file via this form.

Post-Lab Questions — DUE BY START OF FEB 24 LECTURE

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

One of the great parts about having an automated robot is being able to precisely mix, deposit, and run reactions without much intervention, and design and deploy experiments remotely.

For this week, we’d like for you to do the following:

  1. Find and describe a published paper that utilizes the Opentrons or an automation tool to achieve novel biological applications.
  2. Write a description about what you intend to do with automation tools for your final project. You may include example pseudocode, Python scripts, 3D printed holders, a plan for how to use Ginkgo Nebula, and more. You may reference this week’s recitation slide deck for lab automation details.

While your description/project idea doesn’t need to be set in stone, we would like to see core details of what you would automate. This is due at the start of lecture and does not need to be tested on the Opentrons yet.

Example 1: You are creating a custom fabric, and want to deposit art onto specific parts that need to be intertwined in odd ways. You can design a 3D printed holder to attach this fabric to it, and be able to deposit bio art on top. Check out the Opentrons 3D Printing Directory.

Example 2: You are using the cloud laboratory to screen an array of biosensor constructs that you design, synthesize, and express using cell-free protein synthesis.

  1. Echo transfer biosensor constructs and any required cofactors into specified wells.
  2. Bravo stamp in CPFS reagent master mix into all wells of a 96-well / 384-well plate.
  3. Multiflo dispense the CFPS lysate to all wells to start protein expression.
  4. PlateLoc seal the plate.
  5. Inheco incubate the plate at 37°C while the biosensor proteins are synthesized.
  6. XPeel remove the seal.
  7. PHERAstar measure fluorescence to compare biosensor responses.

Final Project Ideas — DUE BY START OF FEB 24 LECTURE

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

As explained in this week’s recitation, add 1-3 slides with 3 ideas you have for an Individual Final Project in the appropriate slide deck for MIT/Harvard/Wellesley students or for Commited Listeners. Be sure to put your name on your slide(s); for CLs, also put your city and country on your slide(s) and be sure you’re putting your slide(s) in your Node’s section of the deck.


Reading & Resources (click to expand)

Subsections of Week 3 (Feb 17)

Week 4 — Protein Design Part I

This week focuses on how sequence, structure, and energetics can be modeled and manipulated to create or optimize proteins with specified functions.

Lecture (Tues, Feb 24)

Protein Design Part I
(▶️Recording)
Thras Karydis, Jon Kaufman

Recitation (Wed, Feb 25)

Protein folding
(▶️Recording)
Allan Costa

Lab (Thurs-Fri, Feb 26 - 27)

Lab work this week is contained within the homework assignment below.

Homework: Protein Design I — DUE BY START OF MAR 3 LECTURE

Objective:

  1. Learn basic concepts:
    • amino acid structure
    • 3D protein visualization
    • the variety of ML-based design tools
  2. Brainstorm as a group how to apply these tools to engineer a better bacteriophage (setting the stage for the final project).

Part A. Conceptual Questions

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

Answer any NINE of the following questions from Shuguang Zhang: (i.e. you can select two to skip)

  1. How many molecules of amino acids do you take with a piece of 500 grams of meat? (on average an amino acid is ~100 Daltons)
  2. Why do humans eat beef but do not become a cow, eat fish but do not become fish?
  3. Why are there only 20 natural amino acids?
  4. Can you make other non-natural amino acids? Design some new amino acids.
  5. Where did amino acids come from before enzymes that make them, and before life started?
  6. If you make an α-helix using D-amino acids, what handedness (right or left) would you expect?
  7. Can you discover additional helices in proteins?
  8. Why are most molecular helices right-handed?
  9. Why do β-sheets tend to aggregate?
    • What is the driving force for β-sheet aggregation?
  10. Why do many amyloid diseases form β-sheets?
    • Can you use amyloid β-sheets as materials?
  11. Design a β-sheet motif that forms a well-ordered structure.

Part B: Protein Analysis and Visualization

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

In this part of the homework, you will be using online resources and 3D visualization software to answer questions about proteins. Pick any protein (from any organism) of your interest that has a 3D structure and answer the following questions:

  1. Briefly describe the protein you selected and why you selected it.
  2. Identify the amino acid sequence of your protein.
    • How long is it? What is the most frequent amino acid? You can use this Colab notebook to count the frequency of amino acids.
    • How many protein sequence homologs are there for your protein? Hint: Use Uniprot’s BLAST tool to search for homologs.
    • Does your protein belong to any protein family?
  3. Identify the structure page of your protein in RCSB
    • When was the structure solved? Is it a good quality structure? Good quality structure is the one with good resolution. Smaller the better (Resolution: 2.70 Å)
    • Are there any other molecules in the solved structure apart from protein?
    • Does your protein belong to any structure classification family?
  4. Open the structure of your protein in any 3D molecule visualization software:
    • PyMol Tutorial Here (hint: ChatGPT is good at PyMol commands)
    • Visualize the protein as “cartoon”, “ribbon” and “ball and stick”.
    • Color the protein by secondary structure. Does it have more helices or sheets?
    • Color the protein by residue type. What can you tell about the distribution of hydrophobic vs hydrophilic residues?
    • Visualize the surface of the protein. Does it have any “holes” (aka binding pockets)?

Part C. Using ML-Based Protein Design Tools

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

In this section, we will learn about the capabilities of modern protein AI models and test some of them in your chosen protein.

  1. Copy the HTGAA_ProteinDesign2026.ipynb notebook and set up a colab instance with GPU.
  2. Choose your favorite protein from the PDB.
  3. We will now try multiple things in the three sections below; report each of these results in your homework writeup on your HTGAA website:

C1. Protein Language Modeling

Picture Source: Bordin, Nicola et al (2023). Novel machine learning approaches revolutionize protein knowledge. Trends in Biochemical Sciences, Volume 48, Issue 4, 345 - 359

Picture Source: Bordin, Nicola et al (2023). Novel machine learning approaches revolutionize protein knowledge. Trends in Biochemical Sciences, Volume 48, Issue 4, 345 - 359

  1. Deep Mutational Scans
    1. Use ESM2 to generate an unsupervised deep mutational scan of your protein based on language model likelihoods.
    2. Can you explain any particular pattern? (choose a residue and a mutation that stands out)
    3. (Bonus) Find sequences for which we have experimental scans, and compare the prediction of the language model to experiment.
  2. Latent Space Analysis
    1. Use the provided sequence dataset to embed proteins in reduced dimensionality.
    2. Analyze the different formed neighborhoods: do they approximate similar proteins?
    3. Place your protein in the resulting map and explain its position and similarity to its neighbors.

C2. Protein Folding

Picture Source: Lin et al (2023). Evolutionary-scale prediction of atomic-level protein structure with a language model.

Picture Source: Lin et al (2023). Evolutionary-scale prediction of atomic-level protein structure with a language model.

Folding a protein

  1. Fold your protein with ESMFold. Do the predicted coordinates match your original structure?
  2. Try changing the sequence, first try some mutations, then large segments. Is your protein structure resilient to mutations?

C3. Protein Generation

Picture Source: 1. Post from Sergey Ovchinnikov 2. Roney, Ovchinnikov et al (2022). State-of-the-art estimation of protein model accuracy using AlphaFold. Phys. Rev. Lett. 129, 238101

Picture Source: 1. Post from Sergey Ovchinnikov 2. Roney, Ovchinnikov et al (2022). State-of-the-art estimation of protein model accuracy using AlphaFold. Phys. Rev. Lett. 129, 238101

Inverse-Folding a protein: Let’s now use the backbone of your chosen PDB to propose sequence candidates via ProteinMPNN

  1. Analyze the predicted sequence probabilities and compare the predicted sequence vs the original one.
  2. Input this sequence into ESMFold and compare the predicted structure to your original.

Part D. Group Brainstorm on Bacteriophage Engineering

Assignees for this section
MIT/Harvard studentsOptional
Committed ListenersRequired
  1. Find a group of ~3–4 students
  2. Read through the Phage Reading material listed under “Reading & Resources” below.
  3. Review the Bacteriophage Final Project Goals for engineering the L Protein:
    • Increased stability (easiest)
    • Higher titers (medium)
    • Higher toxicity of lysis protein (hard)
  4. Brainstorm Session
    • Choose one or two main goals from the list that you think you can address computationally (e.g., “We’ll try to stabilize the lysis protein,” or “We’ll attempt to disrupt its interaction with E. coli DnaJ.”).
    • Write a 1-page proposal (bullet points or short paragraphs) describing:
      • Which tools/approaches from recitation you propose using (e.g., “Use Protein Language Models to do in silico mutagenesis, then AlphaFold-Multimer to check complexes.”).
      • Why do you think those tools might help solve your chosen sub-problem?
      • Name one or two potential pitfalls (e.g., “We lack enough training data on phage–bacteria interactions.”).
      • Include a schematic of your pipeline.
    • This resource may be useful: HTGAA Protein Engineering Tools
  5. Each individually put your plan on your HTGAA website
    • Include your group’s short plan for engineering a bacteriophage

Reading & Resources (click to expand)

Tools

Phage Reading

Subsections of Week 4 (Feb 24)

Lab (Week 4) — Protein Design Part I

This week’s Lab work is effectively part of this week’s Homework; see that assignment and document your work there.

Week 5 — Protein Design Part II

This week we learn how cutting-edge AI and protein language models are used to design functional proteins and peptides “in silico”.

Lecture (Tues, Mar 3)

Protein Design Part II
Gabriele Corso ▶️Recording
Pranam Chatterjee ▶️Recording

Recitation (Wed, Mar 4)

Phage Therapy
(▶️Recording | 💻Slides)
Suvin Sundararajan, Dominika Wawrzyniak

Lab (Thurs-Fri, Mar 5 - 6)

Lab work this week is contained within the homework assignment below.

Homework — DUE BY START OF MAR 10 LECTURE

Part A: SOD1 Binder Peptide Design (From Pranam)

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

Superoxide dismutase 1 (SOD1) is a cytosolic antioxidant enzyme that converts superoxide radicals into hydrogen peroxide and oxygen. In its native state, it forms a stable homodimer and binds copper and zinc.

Mutations in SOD1 cause familial Amyotrophic Lateral Sclerosis (ALS). Among them, the A4V mutation (Alanine → Valine at residue 4) leads to one of the most aggressive forms of the disease. The mutation subtly destabilizes the N-terminus, perturbs folding energetics, and promotes toxic aggregation.

Your challenge:

  1. Design short peptides that bind mutant SOD1.
  2. Then decide which ones are worth advancing toward therapy.

You will use three models developed in our lab:

  • PepMLM: target sequence-conditioned peptide generation via masked language modeling
  • PeptiVerse: therapeutic property prediction
  • moPPIt: motif-specific multi-objective peptide design using Multi-Objective Guided Discrete Flow Matching (MOG-DFM)

Part 1: Generate Binders with PepMLM

  1. Begin by retrieving the human SOD1 sequence from UniProt (P00441) and introducing the A4V mutation.
  2. Using the PepMLM Colab linked from the HuggingFace PepMLM-650M model card:
  3. Generate four peptides of length 12 amino acids conditioned on the mutant SOD1 sequence.
  4. To your generated list, add the known SOD1-binding peptide FLYRWLPSRRGG for comparison.
  5. Record the perplexity scores that indicate PepMLM’s confidence in the binders.

Part 2: Evaluate Binders with AlphaFold3

  1. Navigate to the AlphaFold Server: alphafoldserver.com
  2. For each peptide, submit the mutant SOD1 sequence followed by the peptide sequence as separate chains to model the protein-peptide complex.
  3. Record the ipTM score and briefly describe where the peptide appears to bind. Does it localize near the N-terminus where A4V sits? Does it engage the β-barrel region or approach the dimer interface? Does it appear surface-bound or partially buried?
  4. In a short paragraph, describe the ipTM values you observe and whether any PepMLM-generated peptide matches or exceeds the known binder.

Part 3: Evaluate Properties of Generated Peptides in the PeptiVerse

Structural confidence alone is insufficient for therapeutic development. Using PeptiVerse, let’s evaluate the therapeutic properties of your peptide! For each PepMLM-generated peptide:

  1. Paste the peptide sequence.
  2. Paste the A4V mutant SOD1 sequence in the target field.
  3. Check the boxes
    1. Predicted binding affinity
    2. Solubility
    3. Hemolysis probability
    4. Net charge (pH 7)
    5. Molecular weight

Compare these predictions to what you observed structurally with AlphaFold3. In a short paragraph, describe what you see. Do peptides with higher ipTM also show stronger predicted affinity? Are any strong binders predicted to be hemolytic or poorly soluble? Which peptide best balances predicted binding and therapeutic properties?

Choose one peptide you would advance and justify your decision briefly.

Part 4: Generate Optimized Peptides with moPPIt

Now, move from sampling to controlled design. moPPIt uses Multi-Objective Guided Discrete Flow Matching (MOG-DFM) to steer peptide generation toward specific residues and optimize binding and therapeutic properties simultaneously. Unlike PepMLM, which samples plausible binders conditioned on just the target sequence, moPPIt lets you choose where you want to bind and optimize multiple objectives at once.

  1. Open the moPPit Colab linked from the HuggingFace moPPIt model card
  2. Make a copy and switch to a GPU runtime.
  3. In the notebook:
    1. Paste your A4V mutant SOD1 sequence.
    2. Choose specific residue indices on SOD1 that you want your peptide to bind (for example, residues near position 4, the dimer interface, or another surface patch).
    3. Set peptide length to 12 amino acids.
    4. Enable motif and affinity guidance (and solubility/hemolysis guidance if available). Generate peptides.
  4. After generation, briefly describe how these moPPit peptides differ from your PepMLM peptides. How would you evaluate these peptides before advancing them to clinical studies?

Part B: BRD4 Drug Discovery Platform Tutorial (Gabriele)

Assignees for this section
MIT/Harvard studentsOptional
Committed ListenersOptional
(View Full Screen)

Part C: Final Project: L-Protein Mutants

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

High level summary: The objective of this assignment is to improve the stability and auto-folding of the lysis protein of a MS2-phage. This mechanism is key to the understanding of how phages can potentially solve antibiotic-resistance.

This homework requires computation that might take you a while to run, so please get started early.

(View Full Screen)

Reading & Resources (click to expand)

Subsections of Week 5 (Mar 3)

Lab (Week 5) — Protein Design Part II

This week’s Lab work is effectively part of this week’s Homework; see that assignment and document your work there.

Week 6 — Genetic Circuits Part I: Assembly Technologies

This week we learn core molecular biology tools and techniques for processing and assembling DNA, including PCR and Gibson Assembly.

Lecture (Tues, Mar 10)

Genetic Circuits Part I: Assembly Technologies
(▶️Recording)
Doug Densmore, Traci Haddock

Recitation (Wed, Mar 11)

PCR, Gibson Assembly
(▶️Recording | 💻Slides)
Eyal Perry, Ronan Donovan

(The recording and slides will be posted here when available)

Lab (Thurs-Fri, Mar 12 - 13)

Homework — DUE BY START OF MAR 17 LECTURE

Assignment: DNA Assembly

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired

Answer these questions about the protocol in this week’s lab:

  1. What are some components in the Phusion High-Fidelity PCR Master Mix and what is their purpose?
  2. What are some factors that determine primer annealing temperature during PCR?
  3. There are two methods from this class that create linear fragments of DNA: PCR, and restriction enzyme digests. Compare and contrast these two methods, both in terms of protocol as well as when one may be preferable to use over the other.
  4. How can you ensure that the DNA sequences that you have digested and PCR-ed will be appropriate for Gibson cloning?
  5. How does the plasmid DNA enter the E. coli cells during transformation?
  6. Describe another assembly method in detail (such as Golden Gate Assembly)
    1. Explain the other method in 5 - 7 sentences plus diagrams (either handmade or online).
    2. Model this assembly method with Benchling or Asimov Kernel!

Assignment: Asimov Kernel

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired
  1. Create a Repository for your work
  2. Create a blank Notebook entry to document the homework and save it to that Repository
  3. Explore the devices in the Bacterial Demos Repo to understand how the parts work together by running the Simulator on various examples, following the instructions for the simulator found in the “Info” panel (click the “i” icon on the right to open the Info panel)
  4. Create a blank Construct and save it to your Repository
    1. Recreate the Repressilator in that empty Construct by using parts from the Characterized Bacterial Parts repository
    2. Search the parts using the Search function in the right menu
    3. Drag and drop the parts into the Construct
    4. Confirm it works as expected by running the Simulator (“play” button) and compare your results with the Repressilator Construct found in the Bacterial Demos repository
    5. Document all of this work in your Notebook entry - you can copy the glyph image and the simulator graphs, and paste them into your Notebook
  5. Build three of your own Constructs using the parts in the Characterized Bacterials Parts Repo
    1. Explain in the Notebook Entry how you think each of the Constructs should function
    2. Run the simulator and share your results in the Notebook Entry
    3. If the results don’t match your expectations, speculate on why and see if you can adjust the simulator settings to get the expected outcome

Reading & Resources (click to expand)

Resources

Subsections of Week 6 (Mar 10)

Week 7 — Genetic Circuits Part II: Neuromorphic Circuits

This week covers neuromorphic genetic circuits, showing how engineered gene networks can implement neural-network “perceptron”-like computation and learning.

Lecture (Tues, Mar 17)

Genetic Circuits Part II: Neuromorphic Circuits
(▶️Recording)
Ron Weiss

Recitation (Wed, Mar 18)

Neuromorphic circuits & Biomaterials
(▶️Recording | 💻Slides)
Evan Holbrook, Ren Ramlan

Lab (Thurs-Fri, Mar 19 - 20)

Homework — DUE BY Mar 31 2PM ET

Assignment Part 1: Intracellular Artificial Neural Networks (IANNs)

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired
  1. What advantages do IANNs have over traditional genetic circuits, whose input/output behaviors are Boolean functions?
  2. Describe a useful application for an IANN; include a detailed description of input/output behavior, as well as any limitations an IANN might face to achieve your goal.
  3. Below is a diagram depicting an intracellular single-layer perceptron where the X1 input is DNA encoding for the Csy4 endoribonuclease and the X2 input is DNA encoding for a fluorescent protein output whose mRNA is regulated by Csy4. Tx: transcription; Tl: translation. Draw a diagram for an intracellular multilayer perceptron where layer 1 outputs an endoribonuclease that regulates a fluorescent protein output in layer 2.

Assignment Part 2: Fungal Materials

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired
  1. What are some examples of existing fungal materials and what are they used for? What are their advantages and disadvantages over traditional counterparts?
  2. What might you want to genetically engineer fungi to do and why? What are the advantages of doing synthetic biology in fungi as opposed to bacteria?

Assignment Part 3: First DNA Twist Order

Assignees for this section
MIT/Harvard studentsRequired
Committed ListenersRequired
  1. Review the Individual Final Project documentation guidelines.
  2. Submit this Google Form with your draft Aim 1, final project summary, HTGAA industry council selections, and shared folder for DNA designs. DUE MARCH 20 FOR MIT/HARVARD/WELLESLEY STUDENTS
  3. Review Part 3: DNA Design Challenge of the week 2 homework. Design at least 1 insert sequence and place it into the Benchling/Kernel/Other folder you shared in the Google Form above. Document the backbone vector it will be synthesized in on your website.

Reading & Resources (click to expand)

Subsections of Week 7 (Mar 17)

Week 9 — Cell-Free Systems

This week introduces synthesis of proteins using cellular machinery outside of a cell.

Lecture (Tues, Mar 31)

Cell-Free Systems
Kate Adamala, Peter Nguyen, Ally Huang

(The recording will be posted here when available)

Recitation (Wed, Apr 1)

Cell-free protein synthesis
Ben Arias-Almeida, Ice Kiattisewee

(The recording and slides will be posted here when available)

Lab (Thurs-Fri, Apr 2 - 3)

Homework — DUE BY START OF Apr 7 LECTURE

(View Full Screen)

Reading & Resources (click to expand)

Subsections of Week 9 (Mar 31)

Week 10 — Advanced Imaging & Measurement Technology

This lecture presents a range of advanced technologies to do precision measurement of proteins at atomic scales, characterizing chemical composition, and detecting protein sequence and structure.

Lecture (Tues, Apr 7)

Advanced Imaging & Measurement Tech
Evan Daugharthy, Waters Corp.

(The recording will be posted here when available)

Recitation (Wed, Apr 8)

Mass spectrometry
Waters Corp. Team

(The recording and slides will be posted here when available)

Lab (Thurs-Fri, Apr 9 - 10)

Homework — DUE BY START OF Apr 14 LECTURE

(View Full Screen)

Reading & Resources (click to expand)

Subsections of Week 10 (Apr 7)

Lab (Week 10) — Mass Spectrometry

TBD.

Week 11 — Bioproduction & Cloud Labs

This week examines how modern bioproduction pipelines, from strain engineering to fermentation and downstream processing, are increasingly designed, executed, and optimized through cloud lab platforms and automation — enabling remote, high-throughput, and reproducible synthetic biology at industrial scale.

Lecture (Tues, Apr 14)

Bioproduction & Cloud Labs
Reshma Shetty

(The recording will be posted here when available)

Recitation (Wed, Apr 15)

Cloud laboratories
Ronan Donovan

(The recording and slides will be posted here when available)

Lab (Thurs-Fri, Apr 16 - 17)

Homework — DUE BY START OF APR 21 LECTURE

(TBD)


Reading & Resources (click to expand)

Subsections of Week 11 (Apr 14)

Week 12 — Building Genomes

This week focuses on designing, synthesizing, and editing whole genomes, from minimal cells to refactored microbes and synthetic chromosomes.

Lecture (Tues, Apr 21)

Building Genomes
George Church, John Glass, Jef Boeke

(The recording will be posted here when available)

Recitation (Wed, Apr 22)

CRISPR-based Metabolic Engineering
Ice Kiattisewee

(The recording and slides will be posted here when available)

Lab (Thurs-Fri, Apr 23 - 24)

Homework — DUE BY START OF APR 28 LECTURE

(TBD)


Reading & Resources (click to expand)

Subsections of Week 12 (Apr 21)

Week 13 — Biodesign & Engineered Living Materials

This week covers designing, programming, and fabricating engineered living materials — such as self-healing concretes, adaptive biofilms, and responsive biomaterials — by integrating genetic circuit design, materials science, and bioprocess engineering.

Lecture (Tues, Apr 28)

Biodesign & Engineered Living Materials; Frugal Science
Manu Prakash, David Kong

(The recording will be posted here when available)

Recitation (Wed, Apr 29)

Printing mycelium in Bambu Labs X1 Carbon 3D printer
Ren Ramlan

(The recording and slides will be posted here when available)

Lab (Thurs-Fri, Apr 30 - May 1)

Homework: Work on your Final Project
Present it May 12 (MIT/Harvard) or May 13 (Committed Listeners)


Reading & Resources (click to expand)

Subsections of Week 13 (Apr 28)

Lab (Week 13) — Final Project Labwork

No Lab Assignment this week.

Final Project Lab time available

If your final project requires lab work, you can schedule a block of lab time this week.

Week 14 — Bio Design & Bio Fabrication

We wrap up the term looking towards a future of Bio-Design and Bio-Fabrication.

Lecture (Tues, May 5)

Bio Design & Bio Fabrication
Suzanne Lee, Christina Agapakis

(The recording will be posted here when available)

Recitation (Wed, May 6)

TBD

(The recording and slides will be posted here when available)

Lab (Thurs-Fri, May 7 - 8)

Homework: Finish your Final Project
Present it May 12 (MIT/Harvard) or May 13 (Committed Listeners)


Reading & Resources (click to expand)

Subsections of Week 14 (May 5)

Lab (Week 14) — Final Project Labwork

No Lab Assignment this week.

Final Project Lab time available

If your final project requires lab work, you can schedule a block of lab time this week.